FOXO4-DRI

Product Name:

FOXO4-DRI (FOXO4 D-Retro-Inverso)

Chemical Information:

• Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄
• Molecular Weight: ~5358 g/mol
• Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (D-amino acids; retro-inverso)
• Structure Class: Synthetic peptide (D-retro-inverso configuration)

Molecular Structure:

+
−

Product Description:

FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a defined peptide sequence. The retro-inverso design and D-residue composition are utilized in research to examine peptide stability and interaction characteristics in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.

Research Applications:

FOXO4-DRI is utilized in controlled laboratory research settings for applications such as:

• Evaluation of D-retro-inverso peptide behavior in stability and interaction assays
• Investigation of peptide–protein binding interactions in defined assay systems
• Comparative analysis of L- and D-configured peptide structures under controlled conditions
• Development of in vitro assay systems for studying peptide interaction characteristics

Storage and Handling:

• Store lyophilized powder at −20 °C until use
• Once reconstituted, store at 2–8 °C and use promptly
• Maintain aseptic technique during handling

Product Specifications:

• Purity: ≥99% (HPLC/LC-MS Verified)
• Appearance: Lyophilized white powder
• Solubility: Soluble in suitable laboratory agents

Compliance Notice:

FOXO4-DRI is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.